PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43698.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 297aa    MW: 32636.9 Da    PI: 6.2732
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43698.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.91e-33457760
      zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                +cprC s+ntkfCyynn sl+qPryfCk+CrryWtkGG+lrnvPvGgg++kn++
  KHN43698.1  4 NCPRCGSSNTKFCYYNNCSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCKKNRR 57
                7***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.493357IPR003851Zinc finger, Dof-type
PfamPF027014.1E-29457IPR003851Zinc finger, Dof-type
PROSITE patternPS013610541IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-19548IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSPNCPRCGS SNTKFCYYNN CSLTQPRYFC KGCRRYWTKG GSLRNVPVGG GCKKNRRGNK  60
TLLRQSIDGF TFKNSSPPCG YATDHNNNPL GHSYDPRIRA SSASSSSSVV TDGPNIDLAL  120
VFANFLNQKP NSSEGGVESS TNPDQEQTVF DPSLENNSRL SNTDVVGPST LPEELGLTGC  180
LNLPEQQPHT HSSEANNNNN QMCYGEFNTM QTLQKDGIEQ YSSHGGAMNF ELPPLPGEGE  240
ASHDHHMMWS NSEMMINHHA FQVTQPPLLG LEVHDADLLI GNWSPFDSPK DTSFSRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518176.20.0PREDICTED: dof zinc finger protein DOF3.5-like
TrEMBLA0A0B2SFX60.0A0A0B2SFX6_GLYSO; Dof zinc finger protein DOF3.5
STRINGGLYMA02G35296.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-37Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]